Q&A Discussions

What is the difference Between SQL and NoSQL databases?
databasesmysqlnosqlsqlsqlite
1 Vote
1 Answer
7th Oct 2020, 8:07 AM
Aditya Raut
Pentaho link ?
databasesdatawarhouseetlpentahosoftwaretalend
0 Votes
3 Answers
4th Feb 2022, 8:12 PM
Izmiir
Izmiir - avatar
DATA warehouse
databasesdatawarehouseetlpythonreportsoftware
0 Votes
2 Answers
25th Feb 2022, 6:13 PM
Izmiir
Izmiir - avatar
How do i connect a HTML and C++ together to work with a application?
apic++databaseshelphtmlprogramming
2 Votes
2 Answers
13th Apr 2018, 9:08 AM
Golden Boy
Golden Boy - avatar
Which DBMS would you use in a Raspberrypi?
cdatabasesjavapythonraspberry
1 Vote
1 Answer
24th Jan 2019, 2:37 PM
Paula Romero
Paula Romero - avatar
Como creo servidores y bases de datos?
backendbasesdedatosdatabasesmysqlphpsql
0 Votes
2 Answers
10th Oct 2020, 1:09 PM
javier
javier - avatar
Php vs node.js vs asp.net?
.netback-enddatabasesjsnodephpserver-sidevswebdevelopmentwebsite
3 Votes
4 Answers
13th May 2018, 3:51 PM
Pink Floyd
Pink Floyd - avatar
Insert and create multiple rows with the same value info into the table SQL (mysql)
databasesinsertmysqlsql,values,
0 Votes
1 Answer
20th Sep 2018, 4:50 PM
Lady Lier
How to get a notification pop-up
cssdatabaseshtmljavascriptjquery
0 Votes
1 Answer
8th Mar 2017, 5:17 PM
Rohit Jangid
Rohit Jangid - avatar
Is SQL considered a programming language? And what is a DSL?
basicsc#conceptdatabasesDSLscripting-languagessql
3 Votes
1 Answer
3rd Nov 2016, 4:14 PM
Hanike T.
Hanike T. - avatar
Data Warehouse
databasesdatawarehouseetlolapotlptalend
0 Votes
1 Answer
22nd Feb 2022, 8:08 PM
Izmiir
Izmiir - avatar
Cryptography SQlite ?
cryptographydatabasesrdbmssoftwareengineeringsqlsqlite
0 Votes
1 Answer
9th Jan 2022, 8:57 AM
Izmiir
Izmiir - avatar
How can i build real time multiplayer rock paper scissors game?
c#databasesgamesmobilemultiplayernetworkingweb
3 Votes
1 Answer
22nd Apr 2017, 8:39 PM
Talha Altınel
Talha Altınel - avatar
How many and what programming languages should I learn to be really good in web development?
cssdatabasesdesigndevelopmenthtmljavascriptserversweb
2 Votes
4 Answers
19th Mar 2017, 9:47 PM
Martin Wyszynski
What is the Best place to learn about Databases?
data-typesdatabasesmysqlphpphpmyadminsql
0 Votes
2 Answers
12th Nov 2017, 9:52 PM
Brayan Jeshua
Brayan Jeshua - avatar
Is it possible to create a plugin or anything for Excel to convert sheets to databases?
c#c++databasesideamicrosoftmysqlofficeexcel
0 Votes
3 Answers
20th Aug 2017, 12:52 AM
Henrique Blay Barboza
Henrique Blay Barboza - avatar
I need help with and idea I have for a company need a very experienced python programmer
aiblockchaindatabasesgeneralmoneymulittenanttranfers
0 Votes
1 Answer
5th Jun 2018, 11:18 PM
Brian Grady
Brian Grady - avatar
sorting emails by domain in php
databasesdomainemailsfiltersmysqlphpphpmyadminsorting
0 Votes
1 Answer
27th Jul 2021, 1:55 PM
Eric Kazhus
Eric Kazhus - avatar
Convert PHP Array to Integer?
data-typesdatabasesdivhtmlmysqlphpserverserver-sidesqlweb
1 Vote
1 Answer
9th Dec 2019, 6:51 PM
Wheres8
Wheres8 - avatar
How to create a button that will redirect user to application in another language (Oracle Apex 5)?
apexdatadatabasedatabasesoracleoracleapexsqlxml
0 Votes
1 Answer
26th Jan 2017, 4:12 PM
Ruchi Patil
Ruchi Patil - avatar
< Previous1...34Next >
Hot today
[OFFICIAL] 💘 Cupid’s Code Picks – Valentine’s Code Challenge 2025 Results
15 Votes
Time up code for data revision
0 Votes
Web vs python
1 Votes
Best Python Calculator Code
1 Votes
I want to learn why this error occurs in "while loop" function of Pythone.Can someone explain to me?
1 Votes
Is there a way to report something wrong?
0 Votes
Animation
1 Votes
Is it possible to see what modules come by default the Code Playground?
0 Votes
While or for loop
0 Votes
how to import in pygame
0 Votes