Discussions Q&R

What is the difference Between SQL and NoSQL databases?
databasesmysqlnosqlsqlsqlite
1 Vote
1 Réponse
7th Oct 2020, 8:07 AM
Aditya Raut
Pentaho link ?
databasesdatawarhouseetlpentahosoftwaretalend
0 Vote
3 Réponses
4th Feb 2022, 8:12 PM
Izmiir
Izmiir - avatar
DATA warehouse
databasesdatawarehouseetlpythonreportsoftware
0 Vote
2 Réponses
25th Feb 2022, 6:13 PM
Izmiir
Izmiir - avatar
How do i connect a HTML and C++ together to work with a application?
apic++databaseshelphtmlprogramming
2 Votes
2 Réponses
13th Apr 2018, 9:08 AM
Golden Boy
Golden Boy - avatar
Which DBMS would you use in a Raspberrypi?
cdatabasesjavapythonraspberry
1 Vote
1 Réponse
24th Jan 2019, 2:37 PM
Paula Romero
Paula Romero - avatar
Como creo servidores y bases de datos?
backendbasesdedatosdatabasesmysqlphpsql
0 Vote
2 Réponses
10th Oct 2020, 1:09 PM
javier
javier - avatar
Php vs node.js vs asp.net?
.netback-enddatabasesjsnodephpserver-sidevswebdevelopmentwebsite
3 Votes
4 Réponses
13th May 2018, 3:51 PM
Pink Floyd
Pink Floyd - avatar
Insert and create multiple rows with the same value info into the table SQL (mysql)
databasesinsertmysqlsql,values,
0 Vote
1 Réponse
20th Sep 2018, 4:50 PM
Lady Lier
How to get a notification pop-up
cssdatabaseshtmljavascriptjquery
0 Vote
1 Réponse
8th Mar 2017, 5:17 PM
Rohit Jangid
Rohit Jangid - avatar
Is SQL considered a programming language? And what is a DSL?
basicsc#conceptdatabasesDSLscripting-languagessql
3 Votes
1 Réponse
3rd Nov 2016, 4:14 PM
Hanike T.
Hanike T. - avatar
Data Warehouse
databasesdatawarehouseetlolapotlptalend
0 Vote
1 Réponse
22nd Feb 2022, 8:08 PM
Izmiir
Izmiir - avatar
Cryptography SQlite ?
cryptographydatabasesrdbmssoftwareengineeringsqlsqlite
0 Vote
1 Réponse
9th Jan 2022, 8:57 AM
Izmiir
Izmiir - avatar
How can i build real time multiplayer rock paper scissors game?
c#databasesgamesmobilemultiplayernetworkingweb
3 Votes
1 Réponse
22nd Apr 2017, 8:39 PM
Talha Altınel
Talha Altınel - avatar
How many and what programming languages should I learn to be really good in web development?
cssdatabasesdesigndevelopmenthtmljavascriptserversweb
2 Votes
4 Réponses
19th Mar 2017, 9:47 PM
Martin Wyszynski
What is the Best place to learn about Databases?
data-typesdatabasesmysqlphpphpmyadminsql
0 Vote
2 Réponses
12th Nov 2017, 9:52 PM
Brayan Jeshua
Brayan Jeshua - avatar
Is it possible to create a plugin or anything for Excel to convert sheets to databases?
c#c++databasesideamicrosoftmysqlofficeexcel
0 Vote
3 Réponses
20th Aug 2017, 12:52 AM
Henrique Blay Barboza
Henrique Blay Barboza - avatar
I need help with and idea I have for a company need a very experienced python programmer
aiblockchaindatabasesgeneralmoneymulittenanttranfers
0 Vote
1 Réponse
5th Jun 2018, 11:18 PM
Brian Grady
Brian Grady - avatar
sorting emails by domain in php
databasesdomainemailsfiltersmysqlphpphpmyadminsorting
0 Vote
1 Réponse
27th Jul 2021, 1:55 PM
Eric Kazhus
Eric Kazhus - avatar
Convert PHP Array to Integer?
data-typesdatabasesdivhtmlmysqlphpserverserver-sidesqlweb
1 Vote
1 Réponse
9th Dec 2019, 6:51 PM
Wheres8
Wheres8 - avatar
How to create a button that will redirect user to application in another language (Oracle Apex 5)?
apexdatadatabasedatabasesoracleoracleapexsqlxml
0 Vote
1 Réponse
26th Jan 2017, 4:12 PM
Ruchi Patil
Ruchi Patil - avatar
< Précédent1...34Suivant >
Aujourd'hui en vedette
New code
1 Votes
Does anyone have the solution for this challenge?
1 Votes
Clean Code
3 Votes
How would you solve the part of the C# Intermediate code project that requires operator overloading?
0 Votes
Why does coding take so long to learn
0 Votes
Solved Ai generated practice the last question
0 Votes
Hello Everyone
0 Votes
Solved# Survey data format in coding for data
0 Votes
How to add unordered lists in HTML.
0 Votes
What is the use of .kt classes in the React Native project
0 Votes